PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A10G0382
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 464aa    MW: 52562.6 Da    PI: 9.7851
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A10G0382genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72.1e-16290336148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT +Ed +l+++vkq+G + W+ Ia+ +  gR +kqc++rw+++l
      Gh_A10G0382 290 KGQWTDDEDRKLKRLVKQYGVRKWAQIAESLV-GRAGKQCRERWHNHL 336
                      799*****************************.*************97 PP

2Myb_DNA-binding54.92.1e-17342384145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++W++eEd +l++a+++ G++ W+ Ia+ ++ gRt++ +k++w+
      Gh_A10G0382 342 KDSWSEEEDRILIEAHAKVGNR-WAEIAKVIP-GRTENAIKNHWN 384
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1401062.22E-6242No hitNo description
PfamPF090323.3E-7344IPR015120Siah interacting protein, N-terminal
SuperFamilySSF497645.23E-2873177IPR008978HSP20-like chaperone
PROSITE profilePS5120313.85173163IPR007052CS domain
CDDcd064688.17E-3475163No hitNo description
PfamPF049691.3E-1477153IPR007052CS domain
Gene3DG3DSA:2.60.40.7903.1E-2077174IPR008978HSP20-like chaperone
PROSITE profilePS5129427.744285340IPR017930Myb domain
SuperFamilySSF466892.01E-30288383IPR009057Homeodomain-like
SMARTSM007174.9E-16289338IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-26291344IPR009057Homeodomain-like
CDDcd001673.67E-14293336No hitNo description
PfamPF139217.5E-19293350No hitNo description
SMARTSM007173.3E-18341389IPR001005SANT/Myb domain
PROSITE profilePS5129422.012341391IPR017930Myb domain
CDDcd001672.15E-13344387No hitNo description
Gene3DG3DSA:1.10.10.601.3E-21345389IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MAEELTLDLE ELRQLQSIAK RPRTLSLISS EIRNLEKTLK ENENGASPVT APQIPTPIST  60
SVKTPVNPAL SYVTLASFSW DQDNDKVKIY VSLEGVEQEK IQTEFKPMSF DVKFHDVQGK  120
NYRCAVPKLN KEIEPEKCKV MVKPTRVIIT LFKASKGNWT DLHYKEDKLK PNLDKERDPM  180
AGIMDLMKAA HQRPYSIQNN VKINKGTMLG STADALLRGF SFPSDAIGGY LPRQTNLEES  240
FLDGLFVDGE ILALTEDKNP NTEMKASMKG DFPKGVLKRN KKVASAALIK GQWTDDEDRK  300
LKRLVKQYGV RKWAQIAESL VGRAGKQCRE RWHNHLRPDI KKDSWSEEED RILIEAHAKV  360
GNRWAEIAKV IPGRTENAIK NHWNATKRRQ NSRKKNKQND KQNGKPQSSI LQDYIRSQNL  420
NTPTNSSTTS ATPSSSTFSE DLSTQFNYFL PEPSESDDSH PLVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C7e-4627939047158MYB PROTO-ONCOGENE PROTEIN
1h89_C7e-4627939047158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.67050.0boll| embryo| leaf| ovule| root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012454623.11e-180PREDICTED: transcription factor MYB44-like isoform X1
TrEMBLA0A0D2T2911e-180A0A0D2T291_G
STRINGPOPTR_0009s04870.11e-95(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42652656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.18e-56myb domain protein 119